| Edit |   |
|---|
| Antigenic Specificity | Nicotinamide N-Methyltransferase/NNMT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nicotinamide N-Methyltransferase/NNMT Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nicotinamide N-Methyltransferase/NNMT. This antibody reacts with human. The Nicotinamide N-Methyltransferase/NNMT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to NNMT(nicotinamide N-methyltransferase) The peptide sequence was selected from the N terminal of NNMT. Peptide sequence MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC. |
|---|
| Other Names | EC 2.1.1.1, nicotinamide N-methyltransferase |
|---|
| Gene, Accession # | NNMT, Gene ID: 4837, Accession: P40261, SwissProt: P40261 |
|---|
| Catalog # | NBP1-55398 |
|---|
| Price | |
|---|
| Order / More Info | Nicotinamide N-Methyltransferase/NNMT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|