| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELMO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB, ICC/IF reported in scientific literature (PMID: 24357722). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELMO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELMO2. This antibody reacts with human. The ELMO2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ELMO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD |
|---|
| Other Names | ced-12 homolog 2, CED12A, ELMO-2, engulfment and cell motility 2, engulfment and cell motility 2 (ced-12 homolog, C. elegans), engulfment and cell motility protein 2, FLJ11656, hCed-12A, KIAA1834CED12CED-12, PH domain protein CED12A, Protein ced-12 homolog A |
|---|
| Gene, Accession # | ELMO2, Gene ID: 63916 |
|---|
| Catalog # | NBP1-84554 |
|---|
| Price | |
|---|
| Order / More Info | ELMO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24357722 |
|---|
| 产品资料 |
|
|