| Edit |   |
|---|
| Antigenic Specificity | CYTB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYTB Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYTB. This antibody reacts with human. The CYTB Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human CYTB. Peptide sequence TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL. |
|---|
| Other Names | cytochrome b, MTCYB, MT-CYB mitochondrially encoded cytochrome b |
|---|
| Gene, Accession # | CYTB, Gene ID: 4519, Accession: NC_012920, SwissProt: NC_012920 |
|---|
| Catalog # | NBP1-79340 |
|---|
| Price | |
|---|
| Order / More Info | CYTB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|