| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cysteinyl Leukotriene R2/CysLTR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cysteinyl Leukotriene R2/CysLTR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cysteinyl Leukotriene R2/CysLTR2. This antibody reacts with human. The Cysteinyl Leukotriene R2/CysLTR2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cysteinyl Leukotriene R2/CysLTR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE |
|---|
| Other Names | CysLT(2), CYSLT2KPG_011, CYSLT2RHG57, CysLTR2, cysteinyl leukotriene CysLT2 receptor, cysteinyl leukotriene receptor 2, G protein-coupled receptor, G-protein coupled receptor GPCR21, G-protein coupled receptor HG57, hGPCR21, HPN321 |
|---|
| Gene, Accession # | CYSLTR2, Gene ID: 57105 |
|---|
| Catalog # | NBP2-13897 |
|---|
| Price | |
|---|
| Order / More Info | Cysteinyl Leukotriene R2/CysLTR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|