| Edit |   |
|---|
| Antigenic Specificity | Cysteine Dioxygenase Type 1 |
|---|
| Clone | 4B4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cysteine Dioxygenase Type 1 Antibody (4B4) from Novus Biologicals is a mouse monoclonal antibody to Cysteine Dioxygenase Type 1. This antibody reacts with human. The Cysteine Dioxygenase Type 1 Antibody (4B4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CDO1 (NP_001792.2, 101 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN |
|---|
| Other Names | CDO, CDO-I, cysteine dioxygenase type 1, Cysteine dioxygenase type I, cysteine dioxygenase, type I, EC 1.13.11.20 |
|---|
| Gene, Accession # | CDO1, Gene ID: 1036, Accession: NP_001792, SwissProt: NP_001792 |
|---|
| Catalog # | H00001036-M09 |
|---|
| Price | |
|---|
| Order / More Info | Cysteine Dioxygenase Type 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|