| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cysteine Conjugate beta-Lyase/CCBL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC, WB reported in scientific literature (PMID: 23451256). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cysteine Conjugate beta-Lyase/CCBL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cysteine Conjugate beta-Lyase/CCBL1. This antibody reacts with human. The Cysteine Conjugate beta-Lyase/CCBL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cysteine Conjugate beta-Lyase/CCBL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF |
| Other Names | cysteine conjugate-beta lyase, cytoplasmic, cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, Cysteine-S-conjugate beta-lyase, EC 2.6.1.64, EC 2.6.1.7, EC 4.4.1.13, FLJ95217, Glutamine transaminase K, glutamine-phenylpyruvate aminotransferase, Glutamine--phenylpyruvate transaminase, GTKMGC29624, KAT1, KATIbeta-lysase, kidney, kyneurenine aminotransferase, kyneurenine aminotransferase), Kynurenine aminotransferase I, kynurenine--oxoglutarate transaminase 1, Kynurenine--oxoglutarate transaminase I |
| Gene, Accession # | CCBL1, Gene ID: 883 |
| Catalog # | NBP1-83317 |
| Price | |
| Order / More Info | Cysteine Conjugate beta-Lyase/CCBL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23451256 |
| 产品资料 |
|
|