| Edit |   |
|---|
| Antigenic Specificity | ELF5 |
|---|
| Clone | 3D10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELF5 Antibody (3D10) from Novus Biologicals is a mouse monoclonal antibody to ELF5. This antibody reacts with human. The ELF5 Antibody (3D10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ELF5 (NP_938195.1, 166 a.a. - 263 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED |
|---|
| Other Names | E74-like factor 5, E74-like factor 5 (ets domain transcription factor), Epithelium-restricted ESE-1-related Ets factor, Epithelium-specific Ets transcription factor 2, ESE2ESE-2, ETS-related transcription factor Elf-5 |
|---|
| Gene, Accession # | ELF5, Gene ID: 2001, Accession: Q9UKW6, SwissProt: Q9UKW6 |
|---|
| Catalog # | H00002001-M01 |
|---|
| Price | |
|---|
| Order / More Info | ELF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|