| Edit |   |
|---|
| Antigenic Specificity | ELF5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELF5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELF5. This antibody reacts with human. The ELF5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ELF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW |
|---|
| Other Names | E74-like factor 5, E74-like factor 5 (ets domain transcription factor), Epithelium-restricted ESE-1-related Ets factor, Epithelium-specific Ets transcription factor 2, ESE2ESE-2, ETS-related transcription factor Elf-5 |
|---|
| Gene, Accession # | ELF5, Gene ID: 2001 |
|---|
| Catalog # | NBP2-57358 |
|---|
| Price | |
|---|
| Order / More Info | ELF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|