| 产品详情 |
| Edit |   |
| Antigenic Specificity | RXFP3/RLN3R1/SALPR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RXFP3/RLN3R1/SALPR Antibody from Novus Biologicals is a rabbit polyclonal antibody to RXFP3/RLN3R1/SALPR. This antibody reacts with human. The RXFP3/RLN3R1/SALPR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RXFP3/RLN3R1/SALPR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG |
| Other Names | G protein-coupled receptor SALPR, GPCR135MGC141998, G-protein coupled receptor SALPR, relaxin 3 receptor 1, Relaxin family peptide receptor 3RLN3 receptor 1, relaxin/insulin-like family peptide receptor 3, relaxin-3 receptor 1, RLN3R1MGC142000, RXFPR3, SALPRG-protein coupled receptor GPCR135, somatostatin and angiotensin-like peptide receptor, Somatostatin- and angiotensin-like peptide receptor |
| Gene, Accession # | RXFP3, Gene ID: 51289 |
| Catalog # | NBP1-91963 |
| Price | |
| Order / More Info | RXFP3/RLN3R1/SALPR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|