| Edit |   |
| Antigenic Specificity | RWDD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RWDD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RWDD1. This antibody reacts with human. The RWDD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RWDD1(RWD domain containing 1) The peptide sequence was selected from the middle region of RWDD1. Peptide sequence KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ. |
| Other Names | DFRP2, DRG family-regulatory protein 2, PTD013, RWD domain containing 1, RWD domain-containing protein 1 |
| Gene, Accession # | RWDD1, Gene ID: 51389, Accession: A8MT24, SwissProt: A8MT24 |
| Catalog # | NBP1-56862-20ul |
| Price | |
| Order / More Info | RWDD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |