| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Muscarinic Acetylcholine Receptor M3/CHRM3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat, bovine |
|---|
| Isotype | n/a |
|---|
| Format | unpurified, no preservative |
|---|
| Size | 0.05 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody from Novus Biologicals is a mouse polyclonal antibody to Muscarinic Acetylcholine Receptor M3/CHRM3. This antibody reacts with human, rat, bovine. The Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CHRM3 (NP_000731, 1 a.a. - 67 a.a.) partial recombinant protein with GST tag. MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ |
|---|
| Other Names | cholinergic receptor, muscarinic 3, HM3, m3 muscarinic receptor, muscarinic acetylcholine receptor M3 |
|---|
| Gene, Accession # | CHRM3, Gene ID: 1131, Accession: NP_000731, SwissProt: NP_000731 |
|---|
| Catalog # | H00001131-A01 |
|---|
| Price | |
|---|
| Order / More Info | Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24828018 |
|---|
| 产品资料 |
|
|