| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRMT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRMT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT1. This antibody reacts with human. The PRMT1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PRMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY |
|---|
| Other Names | ANM1, EC 2.1.1, EC 2.1.1.-, EC 2.1.1.125, EC 2.1.1.77, HCP1, Histone-arginine N-methyltransferase PRMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2, HMT1 hnRNP methyltransferase-like 2 (S. cerevisiae), HMT2, HRMT1L2HMT1 hnRNP methyltransferase-like 2, Interferon receptor 1-bound protein 4, IR1B4protein arginine N-methyltransferase 1, protein arginine methyltransferase 1 |
|---|
| Gene, Accession # | PRMT1, Gene ID: 3276 |
|---|
| Catalog # | NBP2-58031 |
|---|
| Price | |
|---|
| Order / More Info | PRMT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|