| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRL-2/PTP4A2 |
|---|
| Clone | 3C2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRL-2/PTP4A2 Antibody (3C2) from Novus Biologicals is a mouse monoclonal antibody to PRL-2/PTP4A2. This antibody reacts with human. The PRL-2/PTP4A2 Antibody (3C2) has been validated for the following applications: ELISA. |
|---|
| Immunogen | PTP4A2 (NP_003470.1, 1 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC |
|---|
| Other Names | EC 3.1.3.48, HU-PP-1HH13, OV-1PTP4A, PRL-2HH7-2, PRL2protein tyrosine phosphatase IVA, protein tyrosine phosphatase IVA2, protein tyrosine phosphatase type IVA 2, protein tyrosine phosphatase type IVA, member 2, Protein-tyrosine phosphatase 4a2, Protein-tyrosine phosphatase of regenerating liver 2, PTP(CAAXII), PTPCAAX2phosphatase of regenerating liver 2, ptp-IV1a, ptp-IV1b |
|---|
| Gene, Accession # | PTP4A2, Gene ID: 8073 |
|---|
| Catalog # | H00008073-M07 |
|---|
| Price | |
|---|
| Order / More Info | PRL-2/PTP4A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|