| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IMPA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IMPA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IMPA2. This antibody reacts with human. The IMPA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IMPA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI |
|---|
| Other Names | EC 3.1.3.25, IMP 2, IMP.18P, IMPase 2, inosine monophosphatase 2, inositol monophosphatase 2, inositol monophosphatase 2 variant 1, inositol monophosphatase 2 variant 2, inositol(myo)-1(or 4)-monophosphatase 2, Inositol-1(or 4)-monophosphatase 2, Myo-inositol monophosphatase A2 |
|---|
| Gene, Accession # | IMPA2, Gene ID: 3613 |
|---|
| Catalog # | NBP1-86352 |
|---|
| Price | |
|---|
| Order / More Info | IMPA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|