| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Flt-3/Flk-2/CD135 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Flt-3/Flk-2/CD135 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Flt-3/Flk-2/CD135. This antibody reacts with human. The Flt-3/Flk-2/CD135 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Flt-3/Flk-2/CD135 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS |
|---|
| Other Names | CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase 1, STK-1, STK1EC 2.7.10.1, Tyrosine-protein kinase receptor FLT3 |
|---|
| Gene, Accession # | FLT3, Gene ID: 2322 |
|---|
| Catalog # | NBP2-57187 |
|---|
| Price | |
|---|
| Order / More Info | Flt-3/Flk-2/CD135 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|