| Edit |   |
| Antigenic Specificity | SSBP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SSBP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSBP3. This antibody reacts with human. The SSBP3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SSBP3(single stranded DNA binding protein 3) The peptide sequence was selected from the middle region of SSBP3. Peptide sequence DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV. |
| Other Names | CSDP, FLJ10355, single stranded DNA binding protein 3, SSDP1Sequence-specific single-stranded-DNA-binding protein, SSDPsingle-stranded DNA-binding protein 3 |
| Gene, Accession # | SSBP3, Gene ID: 23648, Accession: Q5T860, SwissProt: Q5T860 |
| Catalog # | NBP1-56591 |
| Price | |
| Order / More Info | SSBP3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |