| Edit |   |
| Antigenic Specificity | PNMA-like 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PNMA-like 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNMA-like 1. This antibody reacts with human. The PNMA-like 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PNMAL1 (PNMA-like 1) The peptide sequence was selected from the middle region of PNMAL1)(50ug). Peptide sequence APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ. |
| Other Names | FLJ10781, KIAA1183L, PNMA-like 1, PNMA-like protein 1 |
| Gene, Accession # | PNMAL1, Gene ID: 55228, Accession: Q86V59, SwissProt: Q86V59 |
| Catalog # | NBP1-57723 |
| Price | |
| Order / More Info | PNMA-like 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |