| 产品详情 |
| Edit |   |
| Antigenic Specificity | CBLB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CBLB Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBLB. This antibody reacts with human. The CBLB Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CBLB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP |
| Other Names | Cas-Br-M (murine) ecotropic retroviral transforming sequence b, Cas-Br-M (murine) ectropic retroviral transforming sequence b, Casitas B-lineage lymphoma proto-oncogene b, DKFZp686J10223, DKFZp779A0729, DKFZp779F1443, E3 ubiquitin-protein ligase CBL-B, EC 6.3.2, EC 6.3.2.-, FLJ41152, RING finger protein 56, RNF56FLJ36865, SH3-binding protein CBL-B, Signal transduction protein CBL-B |
| Gene, Accession # | CBLB, Gene ID: 868 |
| Catalog # | NBP1-86601 |
| Price | |
| Order / More Info | CBLB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|