| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | C4 binding protein B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C4 binding protein B Antibody from Novus Biologicals is a rabbit polyclonal antibody to C4 binding protein B. This antibody reacts with human. The C4 binding protein B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to C4BPB (complement component 4 binding protein, beta) The peptide sequence was selected from the N terminal of C4BPB. Peptide sequence CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV. |
|---|
| Other Names | C4b binding protein, beta chain, C4b-binding protein beta chain, C4BP, complement component 4 binding protein, beta, complement component 4 binding protein, beta chain, complement component 4-binding protein, beta |
|---|
| Gene, Accession # | C4BPB, Gene ID: 725, Accession: P20851, SwissProt: P20851 |
|---|
| Catalog # | NBP1-58983 |
|---|
| Price | |
|---|
| Order / More Info | C4 binding protein B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|