| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CBE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CBE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBE1. This antibody reacts with human. The CBE1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CBE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEAR METAVRGMPLECPPRPERLNAYEREVMVNMLN |
|---|
| Other Names | bA573M23.4, C9orf24, CBE1, chromosome 9 open reading frame 24, ciliated bronchial epithelium 1, MGC32921, MGC33614, NYD-SP22, SMRP1, testes development-related NYD-SP22, Testis development protein NYD-SP22 |
|---|
| Gene, Accession # | C9ORF24, Gene ID: 84688 |
|---|
| Catalog # | NBP2-14425 |
|---|
| Price | |
|---|
| Order / More Info | CBE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|