| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CtIP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CtIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CtIP. This antibody reacts with human. The CtIP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CtIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETE |
|---|
| Other Names | CtBP-interacting protein, CtIP, DNA endonuclease RBBP8, EC 3.1, RBBP-8, retinoblastoma binding protein 8, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, RIMSAE2, Sporulation in the absence of SPO11 protein 2 homolog |
|---|
| Gene, Accession # | RBBP8, Gene ID: 5932 |
|---|
| Catalog # | NBP2-55651 |
|---|
| Price | |
|---|
| Order / More Info | CtIP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|