| Edit |   |
|---|
| Antigenic Specificity | CTHRC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTHRC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTHRC1. This antibody reacts with mouse. The CTHRC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Cthrc1 - C-terminal region. Peptide sequence HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL. |
|---|
| Other Names | collagen triple helix repeat containing 1, collagen triple helix repeat-containing protein 1, Protein NMTC1 |
|---|
| Gene, Accession # | CTHRC1, Gene ID: 115908, Accession: NP_081054 |
|---|
| Catalog # | NBP1-98466 |
|---|
| Price | |
|---|
| Order / More Info | CTHRC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|