| Edit |   |
| Antigenic Specificity | CTHRC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CTHRC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTHRC1. This antibody reacts with mouse. The CTHRC1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Cthrc1 - C-terminal region. Peptide sequence HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL. |
| Other Names | collagen triple helix repeat containing 1, collagen triple helix repeat-containing protein 1, Protein NMTC1 |
| Gene, Accession # | CTHRC1, Gene ID: 115908, Accession: NP_081054 |
| Catalog # | NBP1-98466-20ul |
| Price | |
| Order / More Info | CTHRC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |