| Edit |   |
| Antigenic Specificity | CTHRC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CTHRC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTHRC1. This antibody reacts with human. The CTHRC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CTHRC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI |
| Other Names | collagen triple helix repeat containing 1, collagen triple helix repeat-containing protein 1, Protein NMTC1 |
| Gene, Accession # | CTHRC1, Gene ID: 115908, Accession: Q96CG8, SwissProt: Q96CG8 |
| Catalog # | NBP2-31797 |
| Price | |
| Order / More Info | CTHRC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |