| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CTGF/CCN2 |
|---|
| Clone | CL5339 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTGF/CCN2 Antibody (CL5339) from Novus Biologicals is a mouse monoclonal antibody to CTGF/CCN2. This antibody reacts with human, mouse, rat. The CTGF/CCN2 Antibody (CL5339) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CTGF/CCN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG |
|---|
| Other Names | CCN2IGFBP-8, connective tissue growth factor, HCS24, Hypertrophic chondrocyte-specific protein 24, IBP-8, IGF-binding protein 8, IGFBP8CCN family member 2, Insulin-like growth factor-binding protein 8, MGC102839, NOV2 |
|---|
| Gene, Accession # | CTGF, Gene ID: 1490 |
|---|
| Catalog # | NBP2-61415 |
|---|
| Price | |
|---|
| Order / More Info | CTGF/CCN2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|