| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZNF510 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF510 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF510. This antibody reacts with human. The ZNF510 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF510 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFN RKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKS |
| Other Names | BMZF-5FLJ58216, Bone marrow zinc finger 5, HD-ZNF1hematopoietic-derived zinc finger protein, Hematopoietic cell-derived zinc finger protein 1, zinc finger protein 254, Zinc finger protein 539ZNF539, Zinc finger protein 91-like, ZNF91LBMZF5 |
| Gene, Accession # | ZNF510, Gene ID: 22869 |
| Catalog # | NBP2-13578 |
| Price | |
| Order / More Info | ZNF510 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|