| 产品详情 |
| Edit |   |
| Antigenic Specificity | IKIP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IKIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to IKIP. This antibody reacts with human. The IKIP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IKIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSTLRNIRTVKRQEEEDLLRVEEQLGSDTKAIEKLEEEQHALFARDEDLTNKLSDYEPKVEECKTHLPTIESAI |
| Other Names | FLJ31051, I kappa-B kinase-interacting protein, IKBKB interacting protein, IKBKB-interacting protein, IKIPI kappa B kinase interacting protein, IKK interacting protein, IKK-interacting protein, inhibitor of nuclear factor kappa-B kinase-interacting protein |
| Gene, Accession # | IKBIP, Gene ID: 121457 |
| Catalog # | NBP2-58695 |
| Price | |
| Order / More Info | IKIP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|