| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IKB zeta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IKB zeta Antibody from Novus Biologicals is a rabbit polyclonal antibody to IKB zeta. This antibody reacts with human. The IKB zeta Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human IKB zeta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQPFQVRGSQQMIDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPM |
|---|
| Other Names | FLJ30225, FLJ34463, ikappaBzeta, I-kappa-B-zeta, IkappaB-zeta, ikbzeta, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAPIkappa B-zeta variant 3, MAILIKBZikB-zeta, Molecule possessing ankyrin repeats induced by lipopolysaccharide, NF-kappa-B inhibitor zeta, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor |
|---|
| Gene, Accession # | NFKBIZ, Gene ID: 64332 |
|---|
| Catalog # | NBP2-57948 |
|---|
| Price | |
|---|
| Order / More Info | IKB zeta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|