| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IKBKAP |
|---|
| Clone | 6G9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IKBKAP Antibody (6G9) from Novus Biologicals is a mouse monoclonal antibody to IKBKAP. This antibody reacts with human. The IKBKAP Antibody (6G9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | IKBKAP (NP_003631 1242 a.a. - 1331 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL |
|---|
| Other Names | DYS, elongator complex protein 1, ELP1DKFZp781H1425, FD, FLJ12497, IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII), IkappaB kinase complex-associated protein, IKI3, IKK complex-associated protein, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein, p150, TOT1 |
|---|
| Gene, Accession # | ELP1, Gene ID: 8518, Accession: NP_003631, SwissProt: NP_003631 |
|---|
| Catalog # | H00008518-M03 |
|---|
| Price | |
|---|
| Order / More Info | IKBKAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26437462 |
|---|
| 产品资料 |
|
|