| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IkB-beta |
|---|
| Clone | 1B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IkB-beta Antibody (1B5) from Novus Biologicals is a mouse monoclonal antibody to IkB-beta. This antibody reacts with human. The IkB-beta Antibody (1B5) has been validated for the following applications: ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | NFKBIB (AAH15528, 56 a.a. - 145 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA |
|---|
| Other Names | beta, IkappaBbeta, I-kappa-B-beta, IkB-B, IkB-beta, IKBBikB-beta, NF-kappa-B inhibitor beta, NF-kappa-BIB, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Thyroid receptor-interacting protein 9, TR-interacting protein 9, TRIP-9, TRIP9ikappaBbeta |
|---|
| Gene, Accession # | NFKBIB, Gene ID: 4793, Accession: AAH15528, SwissProt: AAH15528 |
|---|
| Catalog # | H00004793-M01 |
|---|
| Price | |
|---|
| Order / More Info | IkB-beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|