| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IkB-beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IkB-beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to IkB-beta. This antibody reacts with human. The IkB-beta Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human IkB-beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL |
|---|
| Other Names | beta, IkappaBbeta, I-kappa-B-beta, IkB-B, IkB-beta, IKBBikB-beta, NF-kappa-B inhibitor beta, NF-kappa-BIB, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Thyroid receptor-interacting protein 9, TR-interacting protein 9, TRIP-9, TRIP9ikappaBbeta |
|---|
| Gene, Accession # | NFKBIB, Gene ID: 4793 |
|---|
| Catalog # | NBP2-57108 |
|---|
| Price | |
|---|
| Order / More Info | IkB-beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|