| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCR1/IL-8RA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCR1/IL-8RA Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXCR1/IL-8RA. This antibody reacts with human. The CXCR1/IL-8RA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CXCR1/IL-8 RA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK |
|---|
| Other Names | CD128, CD181, CD181 antigen, CDw128aC-C, chemokine (C-X-C motif) receptor 1, CKR-1, CMKAR1, C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, High affinity interleukin-8 receptor A, IL-8 receptor type 1, IL-8R A, IL8R1, IL8RAC-C-CKR-1, IL8RBA, interleukin 8 receptor, alpha, interleukin-8 receptor type 1, interleukin-8 receptor type A |
|---|
| Gene, Accession # | CXCR1, Gene ID: 3577 |
|---|
| Catalog # | NBP2-48621 |
|---|
| Price | |
|---|
| Order / More Info | CXCR1/IL-8RA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|