| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZMIZ1/Zimp10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZMIZ1/Zimp10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZMIZ1/Zimp10. This antibody reacts with human. The ZMIZ1/Zimp10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ZMIZ1/Zimp10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT |
|---|
| Other Names | FLJ13541, hZIMP10, KIAA1224Zimp10, MIZ, PIAS-like protein Zimp10, RAI17TRAFIP10, retinoic acid induced 17, Retinoic acid-induced protein 17, RP11-519K18.1, ZIMP10FLJ00092 protein, zinc finger MIZ domain-containing protein 1, zinc finger, MIZ-type containing 1, zinc finger-containing, Miz1, PIAS-like protein on chromosome 10 |
|---|
| Gene, Accession # | ZMIZ1, Gene ID: 57178 |
|---|
| Catalog # | NBP1-92610 |
|---|
| Price | |
|---|
| Order / More Info | ZMIZ1/Zimp10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|