| 产品详情 |
| Edit |   |
| Antigenic Specificity | WWOX |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WWOX Antibody from Novus Biologicals is a rabbit polyclonal antibody to WWOX. This antibody reacts with human. The WWOX Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human WWOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS |
| Other Names | D16S432E, EC 1.1.1, EC 1.1.1.-, FORHHCMA56, FRA16D, Fragile site FRA16D oxidoreductase, SDR41C1, short chain dehydrogenase/reductase family 41C, member 1, WOX1PRO0128, WW domain containing oxidoreductase, WW domain-containing oxidoreductase, WW domain-containing protein WWOX |
| Gene, Accession # | WWOX, Gene ID: 51741 |
| Catalog # | NBP2-47579 |
| Price | |
| Order / More Info | WWOX Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28504702 |
| 产品资料 |
|
|