| 产品详情 |
| Edit |   |
| Antigenic Specificity | VAMP-7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 24880616). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VAMP-7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VAMP-7. This antibody reacts with human. The VAMP-7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human VAMP-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNL |
| Other Names | FLJ54296, SYBL1FLJ53762, synaptobrevin-like 1, Synaptobrevin-like protein 1, tetanus neurotoxin-insensitive VAMP, Tetanus-insensitive VAMP, Ti-VAMP, TIVAMP, VAMP-7FLJ53045, vesicle-associated membrane protein 7 |
| Gene, Accession # | VAMP7, Gene ID: 6845, Accession: P51809 |
| Catalog # | NBP1-80709 |
| Price | |
| Order / More Info | VAMP-7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24880616 |
| 产品资料 |
|
|