| Edit |   |
| Antigenic Specificity | IFLTD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IFLTD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFLTD1. This antibody reacts with human. The IFLTD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IFLTD1(intermediate filament tail domain containing 1) The peptide sequence was selected from the middle region of IFLTD1. Peptide sequence PPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPN. |
| Other Names | FLJ36004, intermediate filament tail domain containing 1, intermediate filament tail domain-containing protein 1, Pas1c1 |
| Gene, Accession # | IFLTD1, Gene ID: 160492, Accession: Q8N9Z9, SwissProt: Q8N9Z9 |
| Catalog # | NBP1-56726-20ul |
| Price | |
| Order / More Info | IFLTD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |