| Edit |   |
|---|
| Antigenic Specificity | TOE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOE1. This antibody reacts with human. The TOE1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TOE1(target of EGR1, member 1 (nuclear)) The peptide sequence was selected from the N terminal of TOE1. Peptide sequence VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY. |
|---|
| Other Names | FLJ13949, target of EGR1 protein 1, target of EGR1, member 1 (nuclear) |
|---|
| Gene, Accession # | TOE1, Gene ID: 114034, Accession: Q96GM8, SwissProt: Q96GM8 |
|---|
| Catalog # | NBP1-53158 |
|---|
| Price | |
|---|
| Order / More Info | TOE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|