| Edit |   |
|---|
| Antigenic Specificity | Heterogeneous Nuclear Ribonucleoprotein (A1-like) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody from Novus Biologicals is a rabbit polyclonal antibody to Heterogeneous Nuclear Ribonucleoprotein (A1-like). This antibody reacts with human. The Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. |
|---|
| Other Names | heterogeneous nuclear ribonucleoprotein A1-like 2, hnRNP A1-like 2, hnRNP core protein A1-like 2, HNRNPA1L, LOC144983, MGC102957 |
|---|
| Gene, Accession # | HNRNPA1L2, Gene ID: 144983, Accession: NP_001011724, SwissProt: NP_001011724 |
|---|
| Catalog # | NBP1-80446 |
|---|
| Price | |
|---|
| Order / More Info | Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|