| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Spermine synthase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Spermine synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Spermine synthase. This antibody reacts with human. The Spermine synthase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Spermine synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPE |
|---|
| Other Names | EC 2.5.1.22, MRSRSpS, Snyder-Robinson X-linked mental retardation syndrome, Spermidine aminopropyltransferase, spermine synthase, SPMSYSRS |
|---|
| Gene, Accession # | SMS, Gene ID: 6611 |
|---|
| Catalog # | NBP1-87813 |
|---|
| Price | |
|---|
| Order / More Info | Spermine synthase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|