| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PKA C beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PKA C beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PKA C beta. This antibody reacts with human. The PKA C beta Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: beta |
|---|
| Immunogen | Synthetic peptides corresponding to PRKACB(protein kinase, cAMP-dependent, catalytic, beta) The peptide sequence was selected from the middle region of PRKACB. Peptide sequence NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI. |
|---|
| Other Names | cAMP-dependent protein kinase catalytic beta subunit isoform 4ab, cAMP-dependent protein kinase catalytic subunit beta, DKFZp781I2452, EC 2.7.11, EC 2.7.11.11, MGC41879, MGC9320, PKA C-beta, PKACb, protein kinase A catalytic subunit beta, protein kinase, cAMP-dependent, catalytic, beta |
|---|
| Gene, Accession # | PRKACB, Gene ID: 5567, Accession: P22694, SwissProt: P22694 |
|---|
| Catalog # | NBP1-55008 |
|---|
| Price | |
|---|
| Order / More Info | PKA C beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|