| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PJA2/Praja2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PJA2/Praja2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PJA2/Praja2. This antibody reacts with human. The PJA2/Praja2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PJA2/Praja2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNTVFELENREAEAYTGLSPPVPSFNCEVRDEFEELDSVPLVKSSAGDTEFVH |
|---|
| Other Names | E3 ubiquitin-protein ligase Praja-2, EC 6.3.2, EC 6.3.2.-, KIAA0438praja2, Neurodap1, praja ring finger 2, Praja2, RING finger protein 131praja 2, RING-H2 motif containing, RNF131 |
|---|
| Gene, Accession # | PJA2, Gene ID: 9867 |
|---|
| Catalog # | NBP1-83006 |
|---|
| Price | |
|---|
| Order / More Info | PJA2/Praja2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|