| Edit |   |
|---|
| Antigenic Specificity | PIWIL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIWIL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIWIL3. This antibody reacts with human. The PIWIL3 Antibody has been validated for the following applications: Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SRTSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSI |
|---|
| Other Names | HIWI3, piwi-like 3 (Drosophila), piwi-like protein 3 |
|---|
| Gene, Accession # | PIWIL3, Gene ID: 440822, Accession: Q7Z3Z3, SwissProt: Q7Z3Z3 |
|---|
| Catalog # | NBP2-31855-25ul |
|---|
| Price | |
|---|
| Order / More Info | PIWIL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30701019 |
|---|