| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fibulin-3/EFEMP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fibulin-3/EFEMP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fibulin-3/EFEMP1. This antibody reacts with human. The Fibulin-3/EFEMP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Fibulin-3/EFEMP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG |
|---|
| Other Names | DHRD, EGF containing fibulin-like extracellular matrix protein 1, EGF-containing fibulin-like extracellular matrix protein 1, Extracellular protein S1-5, FBLN3DRAD, FBNLFLJ35535, FIBL-3, fibrillin-like, Fibrillin-like protein, Fibulin-3, MGC111353, MLVT, MTLV, S1-5 |
|---|
| Gene, Accession # | EFEMP1, Gene ID: 2202 |
|---|
| Catalog # | NBP2-57871 |
|---|
| Price | |
|---|
| Order / More Info | Fibulin-3/EFEMP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|