| Edit |   |
| Antigenic Specificity | HS747E2A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HS747E2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to HS747E2A. This antibody reacts with human. The HS747E2A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human C22orf31. Peptide sequence ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR. |
| Other Names | bK747E2.1, chromosome 22 open reading frame 31, HS747E2A, hypothetical protein LOC25770 |
| Gene, Accession # | C22ORF31, Gene ID: 25770, Accession: NP_056185, SwissProt: NP_056185 |
| Catalog # | NBP1-79705 |
| Price | |
| Order / More Info | HS747E2A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |