| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSD3B7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSD3B7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD3B7. This antibody reacts with human. The HSD3B7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HSD3B7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7) The peptide sequence was selected from the middle region of HSD3B7. Peptide sequence QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTK |
|---|
| Other Names | 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase, 3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-HSD VII, 7-alpha-diol 3-beta-dehydrogenase, C(27) 3-beta-HSD, C(27)-3BETA-HSD, Cholest-5-ene-3-beta, EC 1.1.1.-, EC 1.1.1.181, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase, PFIC4, SDR11E3, short chain dehydrogenase/reductase family 11E, member 3 |
|---|
| Gene, Accession # | HSD3B7, Gene ID: 80270, Accession: Q9H2F3, SwissProt: Q9H2F3 |
|---|
| Catalog # | NBP1-56994 |
|---|
| Price | |
|---|
| Order / More Info | HSD3B7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|