| 产品详情 |
| Edit |   |
| Antigenic Specificity | HSD3B7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HSD3B7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD3B7. This antibody reacts with human. The HSD3B7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HSD3B7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVA AAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG |
| Other Names | 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase, 3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-HSD VII, 7-alpha-diol 3-beta-dehydrogenase, C(27) 3-beta-HSD, C(27)-3BETA-HSD, Cholest-5-ene-3-beta, EC 1.1.1.-, EC 1.1.1.181, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase, PFIC4, SDR11E3, short chain dehydrogenase/reductase family 11E, member 3 |
| Gene, Accession # | HSD3B7, Gene ID: 80270 |
| Catalog # | NBP2-14103 |
| Price | |
| Order / More Info | HSD3B7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|