| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RPA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPA4. This antibody reacts with human. The RPA4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RPA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQV |
|---|
| Other Names | HSU24186, MGC120333, MGC120334, Replication factor A protein 4, replication protein A 30 kDa subunit, replication protein A complex 34 kd subunit homolog Rpa4, replication protein A4, 30kDa, replication protein A4, 34kDa, RF-A protein 4, RP-A p30 |
|---|
| Gene, Accession # | RPA4, Gene ID: 29935 |
|---|
| Catalog # | NBP2-49468 |
|---|
| Price | |
|---|
| Order / More Info | RPA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|