| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EGFL8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EGFL8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EGFL8. This antibody reacts with human. The EGFL8 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EGFL8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG |
|---|
| Other Names | C6orf8, chromosome 6 open reading frame 8, EGF-like protein 8, EGF-like-domain, multiple 8, epidermal growth factor-like protein 8, FLJ44493, FLJ52513, FLJ75166, FLJ97375, MGC44938, MGC59719, NG3FLJ78536, Vascular endothelial statin-2, VE-statin-2 |
|---|
| Gene, Accession # | EGFL8, Gene ID: 80864 |
|---|
| Catalog # | NBP2-49327 |
|---|
| Price | |
|---|
| Order / More Info | EGFL8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|