| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lipase A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lipase A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lipase A. This antibody reacts with human. The Lipase A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Lipase A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF |
|---|
| Other Names | Acid cholesteryl ester hydrolase, Cholesteryl esterase, EC 3.1.1, EC 3.1.1.13, LALCESDcholesterol ester hydrolase, Lipase A, lipase A, lysosomal acid, cholesterol esterase, lysosomal acid lipase, lysosomal acid lipase/cholesteryl ester hydrolase, Sterol esterase |
|---|
| Gene, Accession # | LIPA, Gene ID: 3988 |
|---|
| Catalog # | NBP2-47397 |
|---|
| Price | |
|---|
| Order / More Info | Lipase A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|