| Edit |   |
| Antigenic Specificity | LIN-41/TRIM71 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LIN-41/TRIM71 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LIN-41/TRIM71. This antibody reacts with human. The LIN-41/TRIM71 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LIN-41/TRIM71 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IKSFGFVSSGAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNG |
| Other Names | LIN41, LIN-41, tripartite motif containing 71, tripartite motif-containing protein 71 |
| Gene, Accession # | TRIM71, Gene ID: 131405, Accession: Q2Q1W2, SwissProt: Q2Q1W2 |
| Catalog # | NBP2-34043 |
| Price | |
| Order / More Info | LIN-41/TRIM71 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |